PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009612140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 295aa    MW: 34404.4 Da    PI: 7.725
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009612140.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.6e-163581248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g+WT eEd  l+++++ +G g+W+  ar  g++Rt+k+c++rw++yl
   XP_009612140.1 35 GPWTVEEDFTLINYIAHHGEGRWNFLARSAGLKRTGKSCRLRWLNYL 81
                     89*******************************************97 PP

2Myb_DNA-binding491.4e-1587130146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++ +++++ ++G++ W++Ia++++ gRt++++k++w++
   XP_009612140.1  87 RGNITLEEQLVILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 130
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.1132981IPR017930Myb domain
SuperFamilySSF466892.96E-3031128IPR009057Homeodomain-like
SMARTSM007171.4E-133383IPR001005SANT/Myb domain
PfamPF002493.8E-153581IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-213588IPR009057Homeodomain-like
CDDcd001671.20E-103681No hitNo description
PROSITE profilePS5129422.74982136IPR017930Myb domain
SMARTSM007171.4E-1386134IPR001005SANT/Myb domain
PfamPF002495.0E-1487130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2289135IPR009057Homeodomain-like
CDDcd001673.91E-1091130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MDHHHIKVGL SRGGNYNKNN NHQQQHEEDM DLRQGPWTVE EDFTLINYIA HHGEGRWNFL  60
ARSAGLKRTG KSCRLRWLNY LRPDVRRGNI TLEEQLVILE LHSRWGNRWS KIAQHLPGRT  120
DNEIKNYWRT RVQKHAKQLK CDMNSKQFKD TMRYLWMPRL VERIQAAATT NSNQVTINPN  180
MGISEVVPIH NNNNAINKPR MSENSISTAA SSENSFGTPV SDITDCCYNY PPVISNNQQD  240
YFHQSTQLGE SLTIPTGLEF HAAMDQQNMS QWMDNVWNTE DMWFIQQQLN DNNVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25311344106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9447692e-31GU944769.1 Camellia sinensis MYB mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009612140.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE11e-81MY108_ARATH; Transcription factor MYB108
TrEMBLK4AW021e-128K4AW02_SOLLC; Uncharacterized protein
STRINGSolyc01g057910.2.11e-127(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.12e-87myb domain protein 78